Anti-PREX2 (aa 35-84) polyclonal antibody

Antibody Isotype

IgG

Species Reactivity

Human

Immunogen

Synthetic peptide within Human PREX2 aa 35-84 (N terminal). The exact sequence is proprietary.Sequence: ERDYVGTLEFLVSAFLHRMNQCAASKVDKNVTEETVKMLFSNIEDILAVH Database link: Q70Z35

Conjugate

Application Notes

WB: 1 μg/ml;

Alternative Names

PREX2; phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2; DEP.2; DEPDC2; P-REX2; PPP1R129; 6230420N16Rik; phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein; DEP domain-containing protein 2; PtdIns(3,4,5)-dep

Entrez Gene ID

UniProt ID

Antigen Description

Functions as a RAC1 guanine nucleotide exchange factor (GEF), activating Rac proteins by exchanging bound GDP for free GTP. Its activity is synergistically activated by phosphatidylinositol-3,4,5-triphosphate and the beta gamma subunits of heterotrimeric G protein. Mediates the activation of RAC1 in a PI3K-dependent manner. May be an important mediator of Rac signaling, acting directly downstream of both G protein-coupled receptors and phosphoinositide 3-kinase.

Pathway

Regulation of RAC1 activity;