Recombinant fragment corresponding to Human PPFIBP2 aa 212-305. amino acids 212 to 305Sequence: LRHLKIKVEELENERNQYEWKLKATKAEVAQLQEQVALKDAEIERLHSQL SRTAALHSESHTERDQEIQRLKMGMETLLLANEDKDRRIEELTG Database link: BC021714 Run BLAST with Run BLAST with
Conjugate
Unconjugated
Applications
Application Notes
WB: 1/1000 - 1/2000; IHC-P: 1/100 - 1/500.
Target
Alternative Names
PPFIBP2; PTPRF interacting protein, binding protein 2 (liprin beta 2); liprin-beta-2; Cclp1; protein tyrosine phosphatase receptor type f polypeptide-interacting protein-binding protein 2; MGC42541; DKFZp781K06126;
My Review for Anti-PPFIBP2 (aa 212-305) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
