Anti-PORCN polyclonal antibody (DPABH-10015)

Rabbit anti-Human PORCN (full length) polyclonal antibody for WB Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Full length protein corresponding to Human PORCN aa 1-450. (NP_073736.2).Sequence: MATFSRQEFFQQLLQGCLLPTAQQGLDQIWLLLAICLACRLLWRLGLPSY LKHASTVAGGFFSLYHFFQLHMVWVVLLSLLCYLVLFLCRHSSHRGVFLS VTILIYLLMGEMHMVDTVTWHKMRGAQMIVAMKAVSLGFDLDRGEVGTVP SPVEFMGYLYFVGTIVFGP
Conjugate
Unconjugated

Applications


Application Notes
WB: 1 μg/ml;
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
PORCN; porcupine homolog (Drosophila); PPN; DHOF; FODH; MG61
Entrez Gene ID
UniProt ID

Product Background


Pathway
Signal Transduction; WNT ligand biogenesis and trafficking; Wnt signaling pathway;

Citations


Have you cited DPABH-10015 in a publication? Let us know and earn a reward for your research.

References


Ross, J; Busch, J; et al. A Rare Human Syndrome Provides Genetic Evidence that WNT Signaling Is Required for Reprogramming of Fibroblasts to Induced Pluripotent Stem Cells. CELL REPORTS 9:1770-1780(2014).
Peters, T; Perrier, R; et al. Focal Dermal Hypoplasia: Report of a Case with Myelomeningocele, Arnold- Chiari Malformation and Hydrocephalus with a Review of Neurologic Manifestations of Goltz Syndrome. PEDIATRIC DERMATOLOGY 31:220-224(2014).

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-PORCN polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket