Anti-PLAGL2 polyclonal antibody (DPAB-DC2265)

Mouse anti-Human PLAGL2 (aa 1-100) polyclonal antibody for WB, ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
PLAGL2 (NP_002648, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. The sequence is MTTFFTSVPPWIQDAKQEEEVGWKLVPRPRGREAESQVKCQCEISGTPFSNGEKLRPHSLPQPEQRPYSCPQLHCGKAFASKYKLYRHMATHSAQKPHQC
Conjugate
Unconjugated

Target


Alternative Names
PLAGL2; pleiomorphic adenoma gene-like 2; ZNF900; zinc finger protein PLAGL2; C2H2-type zinc finger protein; pleiomorphic adenoma-like protein 2
Entrez Gene ID
UniProt ID

Citations


Have you cited DPAB-DC2265 in a publication? Let us know and earn a reward for your research.

References


Landrette, S; Perrat, P; et al. Oncogenes PLAG1 and PLAGL2 synergize with CBFB-MYH11 in AML.. BLOOD 100:85A-85A(2002).
Sanciangco, MD; Rocha, LA; et al. A molecular phylogeny of the Grunts (Perciformes: Haemulidae) inferred using mitochondrial and nuclear genes. ZOOTAXA :37-50(2011).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-PLAGL2 polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket