Synthetic peptide corresponding to a region within N terminal amino acids 4-53 (PLALVLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRVVEGLALLD L) of Mouse Pigu (NP_001004721).
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
PIGU; phosphatidylinositol glycan anchor biosynthesis, class U; Cdc91l1; BC028278; 5430426F17Rik; phosphatidylinositol glycan anchor biosynthesis class U protein; protein CDC91-like 1; cell division cycle 91-like 1; GPI transamidase component PIG-U; CDC91
Component of the GPI transamidase complex. May be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.
Pathway
Attachment of GPI anchor to uPAR; Glycosylphosphatidylinositol(GPI)-anchor biosynthesis; Post-translational modification: synthesis of GPI-anchored proteins;
Citations
Publication ()
Have you cited DPABH-28442 in a publication? Let us know and earn a reward for your research.
My Review for Anti-PIGU (aa 4-53) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
