Synthetic peptide within Human SEMCAP3 aa 4-53 (N terminal). The exact sequence is proprietary.Sequence: ELDRFDGDVDPDLKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEGSCP Database link: Q9UPQ7-3
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
PDZRN3; PDZ domain containing ring finger 3; LNX3; SEMACAP3; E3 ubiquitin-protein ligase PDZRN3; ligand of Numb protein X 3; PDZ domain-containing RING finger protein 3; semaphorin cytoplasmic domain-associated protein 3; likely ortholog of mouse semaF cy
SEMCAP3 is widely expressed at high levels, and is thought to be involved in protein/zinc ion binding.
Custom Antibody Labeling
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPABH-13122 in a publication? Let us know and earn a reward for your research.
Hering, DM; Olenski, K; et al. Genome-wide association study for poor sperm motility in Holstein-Friesian bulls. ANIMAL REPRODUCTION SCIENCE 146:89-97(2014).
Katoh, M; Katoh, M; et al. Identification and characterization of PDZRN3 and PDZRN4 genes in silico. INTERNATIONAL JOURNAL OF MOLECULAR MEDICINE 13:607-613(2004).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-PDZRN3 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Certificate of Analysis