Anti-PDXP polyclonal antibody (DPATB-H83429)


Host Species
Antibody Isotype
Species Reactivity
Synthetic peptide corresponding to a region within internal sequence amino acids 180-229 (PWHPLSDGSR TPGTGSLAAA VETASGRQAL VVGKPSPYMF ECITENFSID) of human PDXP (NP_064711). PWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMF ECITENFSID Run BLAST with Run BLAST with


Alternative Names
CIN; PLP; dJ37E16.5
Entrez Gene ID
UniProt ID


Have you cited DPATB-H83429 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling

We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews

Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket


Mulder, J; Wernerus, H; et al. Systematically generated antibodies against human gene products: High throughput screening on sections from the rat nervous system. NEUROSCIENCE 146:1689-1703(2007).

Online Inquiry

Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket