Synthetic peptide within Human PDE4D aa 432-481 (C terminal). The exact sequence is proprietary.Sequence: FQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQ Database link: Q08499-5
Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes.
Pathway
DARPP-32 events; G Protein Signaling Pathways; G alpha (s) signalling events; GPCR downstream signaling; Morphine addiction; Myometrial Relaxation and Contraction Pathways;
Citations
Publication ()
Have you cited DPABH-13954 in a publication? Let us know and earn a reward for your research.
My Review for Anti-PDE4D (aa 432-481) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
