Anti-PDE3B polyclonal antibody (DPAB-DC2167)

Mouse Anti-Human PDE3B (aa 401-500) polyclonal antibody for WB, ELISA

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
PDE3B (NP_000913, 401 a.a. ~ 500 a.a) partial recombinant protein with GST tag. The sequence is LTPFPGFYPCSEIEDPAEKGDRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPKQRSSSVSLTH
Conjugate
Unconjugated

Target


Alternative Names
PDE3B; phosphodiesterase 3B, cGMP-inhibited; HcGIP1; cGIPDE1; cGMP-inhibited 3,5-cyclic phosphodiesterase B; CGIP1
Entrez Gene ID
UniProt ID

Product Background


Pathway
Class IB PI3K non-lipid kinase events; GPCR downstream signaling; IGF1R signaling cascade; IRS-related events

Citations


Have you cited DPAB-DC2167 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Anti-Mouse IgG Fc polyclonal antibody [HRP] DPAB22321 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] DPAB22315 IF Rabbit PDF Inquiry
Anti-Mouse IgG2a polyclonal antibody [Biotin] DPAB22361 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [Biotin] DPAB22306 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [AP] DPAB22304 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] CPBT-68072GM IHC-Fr FC Goat PDF Inquiry
Anti-Mouse IgG monoclonal antibody, clone OX-20 [FITC] CABT-54559RM FC Rat PDF Inquiry
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Hung, SH; Zhang, W; et al. New insights from the structure-function analysis of the catalytic region of human platelet phosphodiesterase 3A - A role for the unique 44-amino acid insert. JOURNAL OF BIOLOGICAL CHEMISTRY 281:29236-29244(2006).
Onuma, H; Osawa, H; et al. A newly identified 50 kDa protein, which is associated with phosphodiesterase 3B, is phosphorylated by insulin in rat adipocytes. BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS 337:976-982(2005).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket