Synthetic peptide corresponding to a region within the N terminal amino acids 35-84 (SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRETEILFHSSLL R) of Human NOL6 (NP_075068)
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
NOL6; nucleolar protein 6 (RNA-associated); NRAP; UTP22; bA311H10.1; nucleolar protein 6; nucleolar RNA-associated protein; nucleolar protein family 6 (RNA-associated);
NOL6 is a nucleolar RNA associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts.
Pathway
Ribosome biogenesis in eukaryotes;
Citations
Publication ()
Have you cited DPABH-18470 in a publication? Let us know and earn a reward for your research.
My Review for Anti-NOL6 (aa 35-84) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
