NODAL (NP_060525, 275 a.a. ~ 346 a.a) partial recombinant protein with GST tag. The sequence is RCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLD HHKDMIVEECGC
The protein encoded by this gene is a member of the TGF-beta superfamily. Studies of the mouse counterpart suggested that this gene may be essential for mesoderm formation and subsequent organization of axial structures in early embryonic development.
Pathway
Cardiac Progenitor Differentiation; Integrated Pancreatic Cancer Pathway; Signaling by NODAL; TGF-beta signaling pathway
Citations
Publication ()
Have you cited DPAB-DC2040 in a publication? Let us know and earn a reward for your research.
My Review for Anti-NODAL (aa 275-346) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
