Anti-NFATC1 polyclonal antibody (DPAB-DC2019)

Mouse anti-Human NFATC1 (aa 701-810) polyclonal antibody for WB, ELISA

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
NFATC1 (NP_006153, 701 a.a. ~ 810 a.a) partial recombinant protein with GST tag. The sequence is IKTEPTDDYEPAPTCGPVSQGLSPLPRPYYSQQLAMPPDPSSCLVAGFPPCPQRSTLMPAAPGVSPKLHDLSPAAYTKGVASPGHCHLGLPQPAGEAPAVQDVPRPVATH
Conjugate
Unconjugated

Target


Alternative Names
NFATC1; nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1; NFAT2; NFATc; NF-ATC; nuclear factor of activated T-cells, cytoplasmic 1
Entrez Gene ID
UniProt ID

Product Background


Pathway
B Cell Receptor Signaling Pathway; BCR signaling pathway; Calcineurin-regulated NFAT-dependent transcription in lymphocytes; Downstream signaling in naive CD8+ T cells

Citations


Have you cited DPAB-DC2019 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Anti-Mouse IgG Fc polyclonal antibody [HRP] DPAB22321 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] DPAB22315 IF Rabbit PDF Inquiry
Anti-Mouse IgG2a polyclonal antibody [Biotin] DPAB22361 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [Biotin] DPAB22306 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [AP] DPAB22304 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] CPBT-68072GM IHC-Fr FC Goat PDF Inquiry
Anti-Mouse IgG monoclonal antibody, clone OX-20 [FITC] CABT-54559RM FC Rat PDF Inquiry
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Nakao, A; Fukushima, H; et al. RANKL-stimulated TNF alpha production in osteoclast precursor cells promotes osteoclastogenesis by modulating RANK signaling pathways. BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS 357:945-950(2007).
Yan, JC; Su, HL; et al. OX40-OX40L Interaction Promotes Proliferation and Activation of Lymphocytes via NFATc1 in ApoE-Deficient Mice. PLOS ONE 8:-(2013).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket