Anti-MTNR1A (aa 296-350) polyclonal antibody

Species Reactivity

Human

Immunogen

MTNR1A (NP_005949, 296 a.a. ~ 350 a.a) partial recombinant protein with GST tag. The sequence is GLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV

Conjugate

Alternative Names

MTNR1A; melatonin receptor 1A; MT1; MEL-1A-R; melatonin receptor type 1A; mel1a receptor;

Entrez Gene ID

UniProt ID

Antigen Description

This gene encodes one of two high affinity forms of a receptor for melatonin, the primary hormone secreted by the pineal gland. This receptor is a G-protein coupled, 7-transmembrane receptor that is responsible for melatonin effects on mammalian circadian rhythm and reproductive alterations affected by day length. The receptor is an integral membrane protein that is readily detectable and localized to two specific regions of the brain. The hypothalamic suprachiasmatic nucleus appears to be involved in circadian rhythm while the hypophysial pars tuberalis may be responsible for the reproductive effects of melatonin.

Pathway

Circadian entrainment; Class A/1 (Rhodopsin-like receptors); GPCR downstream signaling; GPCRs, Class A Rhodopsin-like