ND4 (YP_003024035.1, 406 a.a. ~ 459 a.a) partial recombinant protein with GST tag. The sequence is YSLYIFTTTQWGSLTHHINNIKPSFTRENTLMFIHLSPILLLSLNPDIITGFSS
MT-ND4 (mitochondrially encoded NADH dehydrogenase 4) is a protein-coding gene. Diseases associated with MT-ND4 include leber hereditary optic neuropathy, and leber hereditary optic neuropathy with dystonia, and among its related super-pathways are Electron Transport Chain and Metabolic pathways. GO annotations related to this gene include NADH dehydrogenase (ubiquinone) activity.
Pathway
Electron Transport Chain; NADH:ubiquinone oxidoreductase, mitochondria; Oxidative phosphorylation; Parkinsons disease.
Citations
Publication ()
Have you cited DPAB-DC1965 in a publication? Let us know and earn a reward for your research.
My Review for Anti-MT-ND4 (aa 406-459) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
