Recombinant fragment corresponding to Human MRPS6 aa 52-125.Sequence: SAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQE LKECEGIVPVPLAEKLYSTKKRKK Database link: P82932
Conjugate
Unconjugated
Applications
Application Notes
IHC-P: 1/10 - 1/20.
Target
Alternative Names
MRPS6; mitochondrial ribosomal protein S6; C21orf101, chromosome 21 open reading frame 101; 28S ribosomal protein S6, mitochondrial; MRP S6; RPMS6; S6mt; MRP-S6; C21orf101;
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. MRPS6 encodes a 28S subunit protein that belongs to the ribosomal protein S6P family.
Citations
Publication ()
Have you cited DPABH-14738 in a publication? Let us know and earn a reward for your research.
My Review for Anti-MRPS6 (aa 52-125) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
