RKHD1 (NP_976049, 418 a.a. ~ 488 a.a) partial recombinant protein with GST tag. The sequence is LARECVVCAEGEVMAALVPCGHNLFCMDCAVRICGKSEPECPACRTPATQAIRVETETPQ PGGASALQRQY
Conjugate
Unconjugated
Target
Alternative Names
MEX3D; mex-3 RNA binding family member D; MEX3; TINO; RKHD1; MEX-3D; RNF193; OK/SW-cl.4; RNA-binding protein MEX3D; RING finger protein 193; bcl-2 ARE RNA binding protein; ring finger and KH domain containing 1; RING finger and KH domain-containing protei
MEX3D (mex-3 RNA binding family member D) is a protein-coding gene. GO annotations related to this gene include AU-rich element binding and zinc ion binding. An important paralog of this gene is MEX3B.
Citations
Publication ()
Have you cited DPAB-DC1859 in a publication? Let us know and earn a reward for your research.
My Review for Anti-MEX3D (aa 418-488) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
