Rabbit Anti-MCM3AP Polyclonal antibody (DPABH-15903)

Rabbit Anti-Human MCM3AP Polyclonal antibody for WB, IP, IHC, IF, ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human, Mouse, Rat, Monkey
Immunogen
GANP fusion protein, sequence: IGHEFSGRFFHDRRERRLGGLASQEPGAIIELFNSVLQFLASVVSSEQLCDLSWPVTEFAEAGGSRLLPHLHWNAPEHLAWLKQAVLGFQLPQMDLPPLGAPWLPVCSMVVQYASQIPSSRQTQPVLQSQVENLLHRTYCRWKSKSPSPVHGAGPSVMEIPWDDLIALCINHKLRDWTPPRLPVTSEALSEDGQICVYFFKNDLKKYDVPLSWEQARLQTQKELQLREGRLAIKPFHPSANNFPIPLLHMHRNWKRSTECAQEGRIPSTEDLMRGASAEELLAQCLSSSLLLEKEENKRFEDQLQQWLSEDSGAFTDLTSLPLYLPQTLVSLSHTIEPVMKTSVTTSPQSDMMREQLQLSEATGTCLGERLKHLERLIRSSREEEVASELHLSALLDMVDI (C-term-400aa encoded by BC013285)
Conjugate
unconjugated

Applications


Application Notes
WB: 1:200-1:1000
IP: 0.5-4.0 ug for IP and 1:500-1:1000 for WB
IHC: 1:10-1:100
IF: 1:20-1:200
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
MCM3AP; minichromosome maintenance complex component 3 associated protein; GANP; SAC3; MAP80; germinal-center associated nuclear protein
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-15903 in a publication? Let us know and earn a reward for your research.

References


Hu, YH; Warnatz, HJ; et al. Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins. BMC GENOMICS 7:-(2006).
Wickramasinghe, VO; McMurtrie, PIA; et al. MCM3AP Is Transcribed from a Promoter within an Intron of the Overlapping Gene for GANP. JOURNAL OF MOLECULAR BIOLOGY 406:355-361(2011).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Rabbit Anti-MCM3AP Polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket