MC3R (NP_063941, 1 a.a. ~ 74 a.a) partial recombinant protein with GST tag. The sequence is MSIQKTYLEGDFVFPVSSSSFLRTLLEPQLGSALLTAMNASCCLPSVQPTLPNGSEHLQA PFFSNQSSSAFCEQ
This gene encodes a G-protein-coupled receptor for melanocyte-stimulating hormone and adrenocorticotropic hormone that is expressed in tissues other than the adrenal cortex and melanocytes. This gene maps to the same region as the locus for benign neonatal epilepsy. Mice deficient for this gene have increased fat mass despite decreased food intake, suggesting a role for this gene product in the regulation of energy homeostasis. Mutations in this gene are associated with a susceptibility to obesity in humans.
Pathway
Class A/1 (Rhodopsin-like receptors); GPCR downstream signaling; GPCRs, Class A Rhodopsin-like; Neuroactive ligand-receptor interaction
Citations
Publication ()
Have you cited DPAB-DC1900 in a publication? Let us know and earn a reward for your research.
My Review for Anti-MC3R (aa 1-74) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.