40975 (NP_073737, 66 a.a. ~ 136 a.a) partial recombinant protein with GST tag. The sequence is WYSESEITQGARSRSQNQQRDHDSKRPKLSCTNCTTSAGRNVGNGLNTLSDSSWRHSQVP RSSSMVLGSFG
Conjugate
Unconjugated
Target
Alternative Names
MARCH7; membrane-associated ring finger (C3HC4) 7, E3 ubiquitin protein ligase; AXO; AXOT; RNF177; MARCH-VII; E3 ubiquitin-protein ligase MARCH7; axotrophin; RING finger protein 177; membrane-associated RING-CH protein VII; membrane-associated RING finger
MARCH7 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH proteins add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments (Bartee et al., 2004 [PubMed 14722266]).[supplied by OMIM, Mar 2010]
Citations
Publication ()
Have you cited DPAB-DC2869 in a publication? Let us know and earn a reward for your research.
My Review for Anti-MARCH7 (aa 66-136) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
