Synthetic peptide within Mouse LMTK3 aa 1291-1340 (internal sequence). The exact sequence is proprietary. Immunogen located within 50 amino acid sequenceSequence: RGLLKSPRAADEPEDSELERKRKMVSFHGDVTVYLFDQETPTNELSVQGT Database link: NP_001005511 Run BLAST wit
LMTK3 (lemur tyrosine kinase 3) is a protein-coding gene. Diseases associated with LMTK3 include uterine sarcoma, and cytochrome p450, and among its related super-pathways are Ras Pathway and MAPK Signaling. GO annotations related to this gene include protein tyrosine kinase activity and molecular_function. An important paralog of this gene is LMTK2.
Citations
Publication ()
Have you cited DPABH-11471 in a publication? Let us know and earn a reward for your research.
My Review for Anti-LMTK3 (aa 1291-1340) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
