Synthetic peptide within Human LMAN1L aa 325-374 (internal sequence). The exact sequence is proprietary. (NP_068591)Sequence: GLSKQLAQAERQWKKQLGPPGQARPDGGWALDASCQIPSTPGRGGHLSMS Database link: Q9HAT1
This gene encodes a mitochondrial glutamate carrier. Mutations in this gene are associated with early infantile epileptic encephalopathy. Multiple alternatively spliced variants, encoding the same protein, have been identified.[provided by RefSeq, Jul 2010]
Pathway
Protein processing in endoplasmic reticulum;
Custom Antibody Labeling
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPABH-13003 in a publication? Let us know and earn a reward for your research.
Meschi, J; Crouch, EC; et al. Surfactant protein D binds to human immunodeficiency virus (HIV) envelope protein gp120 and inhibits HIV replication. JOURNAL OF GENERAL VIROLOGY 86:3097-3107(2005).
Adachi, Y; Ishii, T; et al. Characterization of beta-glucan recognition site on C-type lectin, dectin 1. INFECTION AND IMMUNITY 72:4159-4171(2004).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-LMAN1L polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Certificate of Analysis