Synthetic peptide within Human LIPT2 aa 174-223 (C terminal). The exact sequence is proprietary. (NP_001138341)Sequence: TDLTWFEHIVPCGLVGTGVTSLSKELQRHVTVEEVMPPFLVAFKEIYKCT Database link: A6NK57
Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate.
Pathway
Lipoic acid metabolism;
Citations
Publication ()
Have you cited DPABH-12749 in a publication? Let us know and earn a reward for your research.
My Review for Anti-LIPT2 (aa 174-223) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
