Synthetic peptide corresponding to a region within C terminal amino acids 547-596 (MDTRAAASEAPQDVTYAQLHSLTLRRKATEPPPSQEREPPAEPSIYATL A) of Human LILRB2 (NP_005865).
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
LILRB2; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2; leukocyte immunoglobulin-like receptor subfamily B member 2; CD85d; ILT4; LIR 2; LIR2; MIR 10; MIR10; ILT-4; Ig-like transcript 4; immunoglobulin-like transc
Receptor for class I MHC antigens. Recognizes a broad spectrum of HLA-A, HLA-B, HLA-C and HLA-G alleles. Involved in the down-regulation of the immune response and the development of tolerance. Competes with CD8A for binding to class I MHC antigens. Inhibits FCGR1A-mediated phosphorylation of cellular proteins and mobilization of intracellular calcium ions.
Pathway
Adaptive Immune System; Immune System; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell; Osteoclast differentiation;
Citations
Publication ()
Have you cited DPABH-23485 in a publication? Let us know and earn a reward for your research.
My Review for Anti-LILRB2 (aa 547-596) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
