Synthetic peptide corresponding to a region within C terminal amino acids 547-596 (MDTRAAASEAPQDVTYAQLHSLTLRRKATEPPPSQEREPPAEPSIYATL A) of Human LILRB2 (NP_005865).
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
LILRB2; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2; leukocyte immunoglobulin-like receptor subfamily B member 2; CD85d; ILT4; LIR 2; LIR2; MIR 10; MIR10; ILT-4; Ig-like transcript 4; immunoglobulin-like transc
Receptor for class I MHC antigens. Recognizes a broad spectrum of HLA-A, HLA-B, HLA-C and HLA-G alleles. Involved in the down-regulation of the immune response and the development of tolerance. Competes with CD8A for binding to class I MHC antigens. Inhibits FCGR1A-mediated phosphorylation of cellular proteins and mobilization of intracellular calcium ions.
Pathway
Adaptive Immune System; Immune System; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell; Osteoclast differentiation;
Custom Antibody Labeling
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPABH-23485 in a publication? Let us know and earn a reward for your research.
Hunt, JS; Clavellina, CVZ; et al. Investigation of an antibody reported to identify leukocyte immunoglobulin-like receptors (LILRB2) on placental vascular smooth muscle. PLACENTA 31:249-250(2010).
Deng, M; Lu, ZG; et al. A motif in LILRB2 critical for Angptl2 binding and activation. BLOOD 124:924-935(2014).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-LILRB2 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Certificate of Analysis![Mouse Anti-Human LILRB2/CD85d/ILT4 Monoclonal Antibody, clone 398320 [Functional Grade] (CABT-Z501M)](https://img2.creative-diagnostics.com/productimage/CABT-Z501M_1.jpg)
