Recombinant fragment corresponding to Human LEPRE1 aa 347-736.Sequence: MLGEEHTRSIGPRESAKEYRQRSLLEKELLFFAYDVFGIPFVDPDSWTPE EVIPKRLQEKQKSERETAVRISQEIGNLMKEIETLVEEKTKESLDVSRLT REGGPLLYEGISLTMNSKLLNGSQRVVMDGVISDHECQELQRLTNVAATS GDGYRGQTSPHTPNEKFYGVTVFKALKLGQ
Basement membrane-associated chondroitin sulfate proteoglycan (CSPG). Has prolyl 3-hydroxylase activity catalyzing the post-translational formation of 3-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens, especially types IV and V. May be involved in the secretory pathway of cells. Has growth suppressive activity in fibroblasts.
Custom Antibody Labeling
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPABH-10115 in a publication? Let us know and earn a reward for your research.
Michou, L; Brown, JP; et al. Genetics of bone diseases: Paget's disease, fibrous dysplasia, osteopetrosis, and osteogenesis imperfecta. JOINT BONE SPINE 78:252-258(2011).
Roet, KCD; Franssen, EHP; et al. A Multilevel Screening Strategy Defines a Molecular Fingerprint of Proregenerative Olfactory Ensheathing Cells and Identifies SCARB2, a Protein That Improves Regenerative Sprouting of Injured Sensory Spinal Axons. JOURNAL OF NEUROSCIENCE 33:11116-11135(2013).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-LEPRE1 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.