Synthetic peptide corresponding to a region within internal sequence amino acids 381-430 (EIELQSQLSKKAALEKSLEDTKNRYCGQLQMIQEQISNLEAQITDVRQE I) of Human Cytokeratin 9 (NP_000217).
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
KRT9; keratin 9; K9; CK-9; EPPK; keratin, type I cytoskeletal 9; keratin-9; cytokeratin 9; cytokeratin-9; type I cytoskeletal 9;
May serve an important special function either in the mature palmar and plantar skin tissue or in the morphogenetic program of the formation of these tissues. Plays a role in keratin filament assembly.
Citations
Publication ()
Have you cited DPABH-25487 in a publication? Let us know and earn a reward for your research.
My Review for Anti-KRT9 (aa 381-430) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.