Anti-KRT82 (aa 95-144) polyclonal antibody

Antibody Isotype

IgG

Species Reactivity

Human

Immunogen

Synthetic peptide within Human KRT82 aa 95-144 (N terminal). The exact sequence is proprietary.Sequence: VTINESLLVPLALEIDPTVQRVKRDEKEQIKCLNNRFASFINKVRFLEQK Database link: Q9NSB4 Run BLAST with Run BLAST with

Conjugate

Application Notes

WB: 1 μg/ml.

Alternative Names

KRT82; keratin 82; keratin, hair, basic, 2; KRTHB2; keratin, type II cuticular Hb2; hard keratin type II 2; Hb 2; K82; keratin-82; type-II keratin Kb22; keratin, hair, basic, 2; hard keratin, type II, 2; type II hair keratin Hb2; HB2; Hb-2; KRTHB2;

Entrez Gene ID

UniProt ID

Antigen Description

KRT82 is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome 12q13 and are grouped into two distinct subfamilies based on structure similarity. One subfamily, consisting of KRTHB1, KRTHB3, and KRTHB6, is highly related. The other less-related subfamily includes KRTHB2, KRTHB4, and KRTHB5. All hair keratins are expressed in the hair follicle; this keratin appears to be a hair cuticle-specific keratin.