Synthetic peptide within Human KIR2DL3 aa 151-200 (internal sequence). The exact sequence is proprietary.Sequence: GTSVVIILFILLLFFLLHRWCCNKKNAVVMDQEPAGNRTVNREDSDEQDP Database link: P43628-2
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
KIR2DL3; killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3; killer cell immunoglobulin-like receptor 2DL3; CD158B2; cl 6; nkat2; nkat2a; nkat2b; p58; NKAT-2; NK-receptor; p58 NK receptor CL-6; MHC class I NK cell receptor; ki
Receptor on natural killer (NK) cells for HLA-C alleles (HLA-Cw1, HLA-Cw3 and HLA-Cw7). Inhibits the activity of NK cells thus preventing cell lysis.
Pathway
Adaptive Immune System; Antigen processing and presentation; Graft-versus-host disease; Immune System; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell;
Citations
Publication ()
Have you cited DPABH-12903 in a publication? Let us know and earn a reward for your research.
My Review for Anti-KIR2DL3 (aa 151-200) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
