Anti-KCNMB4 polyclonal antibody (DPABH-09924)

Mouse anti-Human KCNMB4 (full length) polyclonal antibody for WB Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Mouse
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Full length protein corresponding to Human KCNMB4 aa 1-210.Sequence: MAKLRVAYEYTEAEDKSIRLGLFLIISGVVSLFIFGFCWLSPALQDLQAT EANCTVLSVQQIGEVFECTFTCGADCRGTSQYPCVQVYVNNSESNSRALL HSDEHQLLTNPKCSYIPPCKRENQKNLESVMNWQQYWKDEIGSQPFTCYF NQHQRPDDVLLHRTHDEIVLLHCFLWPLVTFVV
Conjugate
Unconjugated

Applications


Application Notes
WB: 1 μg/ml.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
KCNMB4; potassium large conductance calcium-activated channel, subfamily M, beta member 4; calcium-activated potassium channel subunit beta-4; hbeta4; BKbeta4; slo-beta-4
Entrez Gene ID
UniProt ID

Product Background


Pathway
Ca2+ activated K+ channels; Hemostasis; Neuronal System; Nitric oxide stimulates guanylate cyclase; Platelet homeostasis; Potassium Channels; Vascular smooth muscle contraction

Citations


Have you cited DPABH-09924 in a publication? Let us know and earn a reward for your research.

References


Hu, H; Shao, LR; et al. Presynaptic Ca2+-activated K+ channels in glutamatergic hippocampal terminals and their role in spike repolarization and regulation of transmitter release. JOURNAL OF NEUROSCIENCE 21:9585-9597(2001).
Piwonska, M; Wilczek, E; et al. Differential distribution of Ca2+-activated potassium channel beta 4 subunit in rat brain: Immunolocalization in neuronal mitochondria. NEUROSCIENCE 153:446-460(2008).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-KCNMB4 polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket