Anti-IZUMO4 (aa 131-210) polyclonal antibody

Antibody Isotype

IgG

Species Reactivity

Human

Immunogen

Recombinant fragment corresponding to Human IZUMO4 aa 131-210. Isoform 2.Sequence: RCGIFQYETISCNNCTDSHVACFGYNCESSAQWKSAVQGLLNYINNWHKQ DTSMSLVSPALRCLEPPHLANLTLEDAAEC Database link: Q1ZYL8-2

Conjugate

Application Notes

IHC-P: 1/20 - 1/50.

Alternative Names

IZUMO4; IZUMO family member 4; C19orf36; IMAGE:4215339; izumo sperm-egg fusion protein 4; sperm 22 kDa protein c113; putative SAMP14 binding protein variant 1; putative SAMP14 binding protein variant 2;

Entrez Gene ID

UniProt ID

Antigen Description

This gene encodes a transmembrane proton-coupled folate transporter protein that facilitates the movement of folate and antifolate substrates across cell membranes, optimally in acidic pH environments. This protein is also expressed in the brain and choroid plexus where it transports folates into the central nervous system. This protein further functions as a heme transporter in duodenal enterocytes, and potentially in other tissues like liver and kidney. Its localization to the apical membrane or cytoplasm of intestinal cells is modulated by dietary iron levels. Mutations in this gene are associated with autosomal recessive hereditary folate malabsorption disease. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Pathway

Fertilization; Sperm:Oocyte Membrane Binding;