Synthetic peptide corresponding to a region within C terminal amino acids 183-232 (SMRPRSSAFSWPGTHRATPAFLVSPALRCLEPPHLANLTLEDAAECLKQ H) of Human IZUMO4; isoform 1 (NP_001034935)
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
IZUMO4; IZUMO family member 4; C19orf36; IMAGE:4215339; izumo sperm-egg fusion protein 4; sperm 22 kDa protein c113; putative SAMP14 binding protein variant 1; putative SAMP14 binding protein variant 2;
My Review for Anti-IZUMO4 (aa 183-232) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
