Synthetic peptide within Human HSFY2 aa 51-100 (internal sequence). The exact sequence is proprietary.Sequence: LSQGSLLESPSYTVCVSEPDKDDDFLSLNFPRKLWKIVESDQFKSISWDE Database link: Q96LI6-3 Run BLAST with Run BLAST with
HSFY2 (heat shock transcription factor, Y linked 2) is a protein-coding gene, and is affiliated with the lncRNA class. Diseases associated with HSFY2 include sertoli cell-only syndrome, and azoospermia. GO annotations related to this gene include sequence-specific DNA binding and sequence-specific DNA binding transcription factor activity. An important paralog of this gene is HSFY1.
Citations
Publication ()
Have you cited DPABH-13032 in a publication? Let us know and earn a reward for your research.
My Review for Anti-HSFY2 (aa 51-100) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
