HOXB7 (NP_004493, 55 a.a. ~ 120 a.a) partial recombinant protein with GST tag. The sequence is MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQR DSDLAA
Conjugate
Unconjugated
Target
Alternative Names
HOXB7; homeobox B7; HOX2; HOX2C; HHO.C1; Hox-2.3; homeobox protein Hox-B7; homeo box 2C; homeo box B7; homeo box c1 protein; homeobox protein HHO.C1; homeobox protein Hox-2C;
This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma.
Citations
Publication ()
Have you cited DPAB-DC1595 in a publication? Let us know and earn a reward for your research.
My Review for Mouse anti-Human HOXB7 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
