Anti-Hepatocyte Growth Factor polyclonal antibody (DPAB-DC1552)

Mouse Anti-Human Hepatocyte Growth Factor polyclonal antibody for WB, ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
HGF (NP_000592, 619 a.a. ~ 728 a.a) partial recombinant protein with GST tag. The sequence is YTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS
Conjugate
Unconjugated

Target


Alternative Names
HGF; hepatocyte growth factor (hepapoietin A; scatter factor); SF; HGFB; HPTA
Entrez Gene ID
UniProt ID

Product Background


Pathway
Arf6 signaling events; Cytokine-cytokine receptor interaction; FGF signaling pathway; Focal adhesion

Citations


Have you cited DPAB-DC1552 in a publication? Let us know and earn a reward for your research.

References


Giacobini, P; Messina, A; et al. Hepatocyte growth factor acts as a motogen and guidance signal for gonadotropin hormone-releasing hormone-1 neuronal migration. JOURNAL OF NEUROSCIENCE 27:431-445(2007).
Thay, B; Damm, A; et al. Aggregatibacter actinomycetemcomitans Outer Membrane Vesicles Are Internalized in Human Host Cells and Trigger NOD1- and NOD2-Dependent NF-kappa B Activation. INFECTION AND IMMUNITY 82:4034-4046(2014).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-Hepatocyte Growth Factor polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket