Synthetic peptide corresponding to a region within the N terminal amino acids 29-78 (AKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKVELQISIY G) of Human GULP1 (NP_057399).
Conjugate
Unconjugated
Target
Alternative Names
GULP1; GULP, engulfment adaptor PTB domain containing 1; CED6; GULP; CED-6; PTB domain-containing engulfment adapter protein 1; engulfment adapter protein; cell death protein 6 homolog; PTB domain adapter protein CED-6; PTB domain adaptor protein CED-6;
May function as an adapter protein. Required for efficient phagocytosis of apoptotic cells. Modulates cellular glycosphingolipid and cholesterol transport. May play a role in the internalization and endosomal trafficking of various LRP1 ligands, such as PSAP. Increases cellular levels of GTP-bound ARF6.
Pathway
Arf6 signaling events;
Citations
Publication ()
Have you cited DPABH-25409 in a publication? Let us know and earn a reward for your research.
My Review for Rabbit anti-Human CED6 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
