Synthetic peptide within Human GPR89A aa 404-453 (C terminal). The exact sequence is proprietary. (NP_057418.1)Sequence: LEYRTIITEVLGELQFNFYHRWFDVIFLVSALSSILFLYLAHKQAPEKQM Database link: B7ZAQ6
Conjugate
Unconjugated
Target
Alternative Names
GPR89A; G protein-coupled receptor 89A; Golgi pH regulator A; UNQ192; protein GPR89; putative MAPK-activating protein PM01; putative NF-kappa-B-activating protein 90; GPR89B; MGC688; FLJ10492; FLJ11696; FLJ36909; FLJ79270; MGC87324;
GPR89 is an Orphan-A GPCR with an unknown ligand. There are multiple copies of the sequence G protein-coupled receptor 89 in the human genome. After consultation with the HUGO Gene Nomenclature committee, the symbol GPR89A was assigned to the most centromeric locus and the symbol GPR89B was assigned to the most telomeric locus.
Citations
Publication ()
Have you cited DPABH-12671 in a publication? Let us know and earn a reward for your research.
My Review for Rabbit anti-Human GPR89A polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
