GPR62 (NP_543141, 314 a.a. ~ 368 a.a) partial recombinant protein with GST tag. The sequence is RACTPQAWHPRALLQCLQRPPEGPAVGPSEAPEQTPELAGGRSPAYQGPPESSLS
GPR62 (G protein-coupled receptor 62) is a protein-coding gene. GO annotations related to this gene include G-protein coupled receptor activity. An important paralog of this gene is GPR61.
Pathway
GPCRs, Other.
Citations
Publication ()
Have you cited DPAB-DC479 in a publication? Let us know and earn a reward for your research.
My Review for Anti-GPR62 (aa 314-368) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
