Anti-GNG5 (aa 1-64) polyclonal antibody

Species Reactivity

Human

Immunogen

GNG5 (NP_005265, 1 a.a. ~ 64 a.a) partial recombinant protein with GST tag. The sequence is MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFR PQKV

Conjugate

Alternative Names

GNG5; guanine nucleotide binding protein (G protein), gamma 5; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5;

Entrez Gene ID

UniProt ID

Antigen Description

G proteins are trimeric (alpha-beta-gamma) membrane-associated proteins that regulate flow of information from cell surface receptors to a variety of internal metabolic effectors. Interaction of a G protein with its activated receptor promotes exchange of GTP for GDP that is bound to the alpha subunit. The alpha-GTP complex dissociates from the beta-gamma heterodimer so that the subunits, in turn, may interact with and regulate effector molecules (Gilman, 1987 [PubMed 3113327]; summary by Ahmad et al., 1995) [PubMed 7606925].[supplied by OMIM, Nov 2010]

Pathway

ADP signalling through P2Y purinoceptor 1; Activation of G protein gated Potassium channels; Activation of Kainate Receptors upon glutamate binding; Alcoholism