Anti-GFM2 polyclonal antibody (DPABH-12102)

Rabbit anti-Human GFM2 (aa 436-612) polyclonal antibody for IHC-P, WB Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Mouse, Human
Immunogen
Recombinant fragment corresponding to Human GFM2 aa 436-612. (BC015712)Sequence: VGLKHTATGDTIVSSKSSALAAARRAEREGEKKHRQNNEAERLLLAGVEI PEPVFFCTIEPPSLSKQPDLEHALKCLQREDPSLKVRLDPDSGQTVLCGM GELHIEIIHDRIKREYGLETYLGPLQVAYRETILNSVRATDTLDRTLGDK RHLVTVEVEARPIETSSVMPV
Conjugate
Unconjugated

Applications


Application Notes
IHC-P: 1/100 - 1/500; WB: 1/200 - 1/1000.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
GFM2; G elongation factor, mitochondrial 2; ribosome-releasing factor 2, mitochondrial; EFG2; FLJ21661; MSTP027
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-12102 in a publication? Let us know and earn a reward for your research.

References


Dixon-Salazar, TJ; Silhavy, JL; et al. Exome Sequencing Can Improve Diagnosis and Alter Patient Management. SCIENCE TRANSLATIONAL MEDICINE 4:-(2012).

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-GFM2 polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket