Synthetic peptide within Human FAM24B aa 18-67 (N terminal). The exact sequence is proprietary.Sequence: VVLCLYFKIHNALKAAKEPEAVAVKNHNPDKVWWAKNSQAKTIATESCPA Database link: Q8N5W8
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
FAM24B; family with sequence similarity 24, member B; protein FAM24B;
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPABH-12617 in a publication? Let us know and earn a reward for your research.
Ewing, JF; Maines, MD; et al. Histochemical localization of heme oxygenase-2 protein and mRNA expression in rat brain. BRAIN RESEARCH PROTOCOLS 1:165-174(1997).
Lee, CEH; Gaeta, B; et al. Reconsidering the human immunoglobulin heavy-chain locus: 1. An evaluation of the expressed human IGHD gene repertoire. IMMUNOGENETICS 57:917-925(2006).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-FAM24B polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Certificate of Analysis