Synthetic peptide within Human FAM155B aa 11-60 (N terminal). The exact sequence is proprietary. Isoform 2 (NP_056501.2).Sequence: KDAAALTICCCCCCWAPRPSDKPCADSERAQRWRLSLASLLFFTVLLADH Database link: O75949-2
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
FAM155B; family with sequence similarity 155, member B; TED; TMEM28; CXorf63; bB57D9.1; transmembrane protein FAM155B; bB57D9.1 (TED protein); transmembrane protein 28;
This gene encodes a member of the BCL-2 family of proteins. This family member belongs to the BH3-only pro-apoptotic subclass. The protein cooperates with direct activator proteins to induce mitochondrial outer membrane permeabilization and apoptosis. It can bind to anti-apoptotic Bcl-2 family members to induce mitochondrial dysfunction and caspase activation. Because of its pro-apoptotic role, this gene is a potential drug target for cancer therapy and for tissue injury. Alternative splicing results in multiple transcript variants.
Citations
Publication ()
Have you cited DPABH-12666 in a publication? Let us know and earn a reward for your research.
My Review for Anti-FAM155B (aa 11-60) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
