Synthetic peptide corresponding to a region within internal sequence amino acids 216-265 (LRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPES P) of Human Factor XIII (NP_001985)
Conjugate
Unconjugated
Applications
Application Notes
WB: Use at a concentration of 1 μg/ml. Predicted molecular weight: 76 kDa. ELISA titre using peptide based assay: 1/62500. Not yet tested in other applications. Optimal dilutions/concentrations should be determined by the end user.
Target
Alternative Names
F13B; coagulation factor XIII, B polypeptide; FXIIIB; coagulation factor XIII B chain; TGase; transglutaminase B chain; fibrin-stabilizing factor B subunit; protein-glutamine gamma-glutamyltransferase B chain;
Factor XIII is activated by thrombin and calcium ions to a transglutaminase that catalyzes the formation of gamma-glutamyl- epsilon-lysine cross-links between fibrin chains, thus stabilizing the fibrin clot. It also cross-links alpha-2-plasmin inhibitor, or fibronectin, to the alpha chains of fibrin. Factor XIII belongs to the transglutaminase family.
Pathway
Blood Clotting Cascade; Complement and Coagulation Cascades; Complement and coagulation cascades; Hemostasis
Citations
Publication ()
Have you cited DPABH-18459 in a publication? Let us know and earn a reward for your research.
My Review for Rabbit anti-Human Factor XIII polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
