Specifications
Immunogen
Other Immunogen Type corresponding to Human EPO Receptor (extracellular). Genetic immunisation with cDNA encoding the Extracellular domain of Human EPO ReceptorSequence: APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGP GNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCS
Applications
Application Notes
Competitive ELISA: 1/200 - 1/400.
Target
Alternative Names
EPOR; erythropoietin receptor; EPO-R; MGC138358;
Product Background
Antigen Description
Receptor for erythropoietin. Mediates erythropoietin-induced erythroblast proliferation and differentiation. Upon EPO stimulation, EPOR dimerizes triggering the JAK2/STAT5 signaling cascade. In some cell types, can also activate STAT1 and STAT3. May also activate the LYN tyrosine kinase.Isoform EPOR-T acts as a dominant-negative receptor of EPOR-mediated signaling.
Pathway
Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; EPO Receptor Signaling, organism-specific biosystem; EPO signaling pathway, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem;
Citations
Publication ()
Have you cited DCABH-6935 in a publication?
Let us know and earn a reward for your research.