Synthetic peptide within Human ENO4 aa 193-242 (N terminal). The exact sequence is proprietary.Sequence: PPVPPPPPPPPPTKKKGQKPGRKDTITEKPIAPAEPVEPVLSGSMAIGAV Database link: A6NNW6
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
ENO4; enolase family member 4; C10orf134; enolase-like protein ENO4;
ENO4 (enolase family member 4) is a protein-coding gene. Diseases associated with ENO4 include pneumonia. GO annotations related to this gene include phosphopyruvate hydratase activity and molecular_function. An important paralog of this gene is ENO3.
Citations
Publication ()
Have you cited DPABH-12650 in a publication? Let us know and earn a reward for your research.
My Review for Anti-ENO4 (aa 193-242) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
