Synthetic peptide within Human EMG1 aa 183-232 (C terminal). The exact sequence is proprietary.Sequence: VSDVRELVPSSDPIVFVVGAFAHGKVSVEYTEKMVSISNYPLSAALTCAK Database link: Q92979
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
EMG1; EMG1 nucleolar protein homolog (S. cerevisiae); ribosomal RNA small subunit methyltransferase NEP1; C2F; Grcc2f; NEP1; essential for mitotic growth 1; ribosome biogenesis protein NEP1; 18S rRNA Psi1248 methyltransferase; 18S rRNA (pseudouridine-N1-)
Involved in 40S ribosomal subunit biogenesis and 18S rRNA processing. Specifically catalyzes the N1-methylation of pseudouridine at position 1248 (Psi1248) in 18S rRNA. Thus, appears to be the methyltransferase involved in the biosynthesis of the hypermodified N1-methyl-N3-(3-amino-3-carboxypropyl) pseudouridine (m1acp3-Psi) in position 1248 in 18S rRNA. Is not able to methylate uridine at this position.
Pathway
Ribosome biogenesis in eukaryotes;
Citations
Publication ()
Have you cited DPABH-14080 in a publication? Let us know and earn a reward for your research.
My Review for Anti-EMG1 (aa 183-232) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
