ELOVL4 (NP_073563, 99 a.a. ~ 154 a.a) partial recombinant protein with GST tag. The sequence is MGSYNAGYSYICQSVDYSNNVHEVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQV
Conjugate
Unconjugated
Target
Alternative Names
ELOVL4; ELOVL fatty acid elongase 4; ADMD; CT118; ISQMR; STGD2; STGD3; elongation of very long chain fatty acids protein 4; ELOVL FA elongase 4; cancer/testis antigen 118; 3-keto acyl-CoA synthase ELOVL4; very-long-chain 3-oxoacyl-CoA synthase 4; elongati
This gene encodes a membrane-bound protein which is a member of the ELO family, proteins which participate in the biosynthesis of fatty acids. Consistent with the expression of the encoded protein in photoreceptor cells of the retina, mutations and small deletions in this gene are associated with Stargardt-like macular dystrophy (STGD3) and autosomal dominant Stargardt-like macular dystrophy (ADMD), also referred to as autosomal dominant atrophic macular degeneration.
My Review for Anti-ELOVL4 (aa 99-154) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
