Anti-eIF4EBP2 (aa 61-120) polyclonal antibody

Species Reactivity

Human

Immunogen

EIF4EBP2 (NP_004087, 61 a.a. ~ 120 a.a) partial recombinant protein with GST tag. The sequence is DRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI

Conjugate

Alternative Names

EIF4EBP2; eukaryotic translation initiation factor 4E binding protein 2; 4EBP2; PHASII; eukaryotic translation initiation factor 4E-binding protein 2; 4E-BP2; eIF4E-binding protein 2; phosphorylated, heat and acid stable regulated by insulin protein II;

Entrez Gene ID

UniProt ID

Antigen Description

This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection.

Pathway

Translation Factors.