Synthetic peptide corresponding to a region within N-terminal amino acids 20-69 (EKEEEAAERTPTGEKSPNSPRTLLSLRGKARTGGPMEVKLELHPLQNRW A) of Human EIF4E1B (NM_001099408).
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
EIF4E1B; eukaryotic translation initiation factor 4E family member 1B; eukaryotic translation initiation factor 4E type 1B;
EIF4E1B (eukaryotic translation initiation factor 4E family member 1B) is a protein-coding gene. Among its related super-pathways are Transcription Receptor-mediated HIF regulation and Integrated Cancer pathway. GO annotations related to this gene include translation initiation factor activity. An important paralog of this gene is EIF4E3.
My Review for Anti-eIF4E1B (aa 20-69) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
