Synthetic peptide within Human Secretory Component Glycoprotein aa 82-131 (internal sequence). The exact sequence is proprietary.Sequence: QDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSH Database link: Q16610-3
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
ECM1; extracellular matrix protein 1; URBWD; secretory component p85;
Involved in endochondral bone formation as negative regulator of bone mineralization. Stimulates the proliferation of endothelial cells and promotes angiogenesis. Inhibits MMP9 proteolytic activity.
Citations
Publication ()
Have you cited DPABH-13130 in a publication? Let us know and earn a reward for your research.
My Review for Anti-ECM1 (aa 82-131) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
