DYNLL2 (NP_542408, 1 a.a. ~ 72 a.a) partial recombinant protein with GST tag. The sequence is MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKH
DYNLL2 (dynein, light chain, LC8-type 2) is a protein-coding gene. Diseases associated with DYNLL2 include chronic lymphocytic leukemia, and rabies, and among its related super-pathways are Activation of BH3-only proteins and Immune System. GO annotations related to this gene include cytoskeletal protein binding and motor activity. An important paralog of this gene is DNAL4.
Pathway
Activation of BH3-only proteins; Adaptive Immune System; Immune System; MHC class II antigen presentation
Citations
Publication ()
Have you cited DPAB-DC604 in a publication? Let us know and earn a reward for your research.
My Review for Anti-DYNLL2 (aa 1-72) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
