Synthetic peptide within Mouse DAAM2 aa 51-99 (N terminal). The exact sequence is proprietary.Sequence: RFAELVDELDLTDKNREAVFALPPEKKWQIYCSKRKEQEDPNKLATSWP Database link: Q80U19 Run BLAST with Run BLAST with
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
DAAM2; dishevelled associated activator of morphogenesis 2; disheveled-associated activator of morphogenesis 2; AI843643; AW557870; 2310016D11Rik;
DAAM2 (dishevelled associated activator of morphogenesis 2) is a protein-coding gene. Diseases associated with DAAM2 include chondrosarcoma, and among its related super-pathways are Wnt Signaling Pathway. GO annotations related to this gene include Rho GTPase binding and actin binding. An important paralog of this gene is DAAM1.
Pathway
Wnt signaling pathway;
Citations
Publication ()
Have you cited DPABH-27749 in a publication? Let us know and earn a reward for your research.
My Review for Anti-DAAM2 (aa 51-99) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
